Lineage for d1pwba2 (1pwb A:205-234)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039232Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 3039233Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 3039305Protein Surfactant protein [57949] (3 species)
  7. 3039306Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)
  8. 3039307Domain d1pwba2: 1pwb A:205-234 [95213]
    Other proteins in same PDB: d1pwba1, d1pwbb1, d1pwbc1
    complexed with ca, glc

Details for d1pwba2

PDB Entry: 1pwb (more details), 1.4 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d with maltose
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d1pwba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwba2 h.1.1.1 (A:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d1pwba2:

Click to download the PDB-style file with coordinates for d1pwba2.
(The format of our PDB-style files is described here.)

Timeline for d1pwba2:

3039307
d1pwba2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1pwba1