| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Herpetosiphon aurantiacus [TaxId:316274] [225738] (1 PDB entry) |
| Domain d3ik4c2: 3ik4 C:127-355 [211750] Other proteins in same PDB: d3ik4a1, d3ik4a3, d3ik4a4, d3ik4b1, d3ik4b3, d3ik4b4, d3ik4c1, d3ik4c3, d3ik4c4, d3ik4d1, d3ik4d3, d3ik4d4 automated match to d1jpma1 complexed with gol, k |
PDB Entry: 3ik4 (more details), 2.1 Å
SCOPe Domain Sequences for d3ik4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ik4c2 c.1.11.0 (C:127-355) automated matches {Herpetosiphon aurantiacus [TaxId: 316274]}
vskqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlraihqaapta
plivdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsgfavaades
arsahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmvesilamsfs
anlaagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnl
Timeline for d3ik4c2: