Lineage for d3ik4d2 (3ik4 D:127-355)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837535Species Herpetosiphon aurantiacus [TaxId:316274] [225738] (1 PDB entry)
  8. 2837539Domain d3ik4d2: 3ik4 D:127-355 [211752]
    Other proteins in same PDB: d3ik4a1, d3ik4a3, d3ik4a4, d3ik4b1, d3ik4b3, d3ik4b4, d3ik4c1, d3ik4c3, d3ik4c4, d3ik4d1, d3ik4d3, d3ik4d4
    automated match to d1jpma1
    complexed with gol, k

Details for d3ik4d2

PDB Entry: 3ik4 (more details), 2.1 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from herpetosiphon aurantiacus
PDB Compounds: (D:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3ik4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ik4d2 c.1.11.0 (D:127-355) automated matches {Herpetosiphon aurantiacus [TaxId: 316274]}
vskqletdmtitagdevhaaasakailargiksikvktagvdvaydlarlraihqaapta
plivdgncgydveralafcaackaesipmvlfeqplpredwagmaqvtaqsgfavaades
arsahdvlriaregtasviniklmkagvaeglkmiaiaqaaglglmiggmvesilamsfs
anlaagnggfdfidldtplfiaehpfiggfaqtggtlqladvaghgvnl

SCOPe Domain Coordinates for d3ik4d2:

Click to download the PDB-style file with coordinates for d3ik4d2.
(The format of our PDB-style files is described here.)

Timeline for d3ik4d2: