Lineage for d3ik4c1 (3ik4 C:2-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948260Species Herpetosiphon aurantiacus [TaxId:316274] [225737] (1 PDB entry)
  8. 2948263Domain d3ik4c1: 3ik4 C:2-126 [211749]
    Other proteins in same PDB: d3ik4a2, d3ik4a3, d3ik4a4, d3ik4b2, d3ik4b3, d3ik4b4, d3ik4c2, d3ik4c3, d3ik4c4, d3ik4d2, d3ik4d3, d3ik4d4
    automated match to d1jpma2
    complexed with gol, k

Details for d3ik4c1

PDB Entry: 3ik4 (more details), 2.1 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from herpetosiphon aurantiacus
PDB Compounds: (C:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3ik4c1:

Sequence, based on SEQRES records: (download)

>d3ik4c1 d.54.1.0 (C:2-126) automated matches {Herpetosiphon aurantiacus [TaxId: 316274]}
pttiqaisaeainlpltepfaiasgaqavaanvlvkvqladgtlglgeaapfpavsgetq
tgtsaaierlqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmplh
vffgg

Sequence, based on observed residues (ATOM records): (download)

>d3ik4c1 d.54.1.0 (C:2-126) automated matches {Herpetosiphon aurantiacus [TaxId: 316274]}
pttiqaisaeainlplteavaanvlvkvqladgtlglgeaapfpavsgetqtgtsaaier
lqshllgadvrgwrklaamldhaeheaaaarcglemamldaltrhyhmplhvffgg

SCOPe Domain Coordinates for d3ik4c1:

Click to download the PDB-style file with coordinates for d3ik4c1.
(The format of our PDB-style files is described here.)

Timeline for d3ik4c1: