SCOPe 2.08: Domain d3ijrf1: 3ijr F:1-288

Lineage for d3ijrf1 (3ijr F:1-288)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries)

8. Domain d3ijrf1: 3ijr F:1-288 [211732]
   Other proteins in same PDB: d3ijrf2, d3ijrh2
   automated match to d1g0oc_
   complexed with mg, nad, so4

Details for d3ijrf1

PDB Entry: 3ijr, 2.05 Å

PDB Description: 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad+

PDB Compounds: (F:) Oxidoreductase, short chain dehydrogenase/reductase family

SCOPe Domain Sequences for d3ijrf1:

Sequence; same for both SEQRES and ATOM records:

>d3ijrf1 c.2.1.0 (F:1-288) automated matches {Bacillus anthracis [TaxId: 261594]}
mpqqknfvtmpaqhqnkqpgieslmnplpqfedpnykgseklkgknvlitggdsgigrav
siafakeganiaiayldeegdanetkqyvekegvkcvllpgdlsdeqhckdivqetvrql
gslnilvnnvaqqypqqgleyitaeqlektfrinifsyfhvtkaalshlkqgdviintas
ivayegnetlidysatkgaivaftrslsqslvqkgirvngvapgpiwtplipssfdekkv
sqfgsnvpmqrpgqpyelapayvylassdssyvtgqmihvnggvivng

Timeline for d3ijrf1:

• d3ijrf1 first appeared in SCOPe 2.03, called d3ijrf_
  
• d3ijrf1 appears in SCOPe 2.07