| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries) |
| Domain d3ijrg_: 3ijr G: [211733] Other proteins in same PDB: d3ijrf2, d3ijrh2 automated match to d1g0oc_ complexed with mg, nad, so4 |
PDB Entry: 3ijr (more details), 2.05 Å
SCOPe Domain Sequences for d3ijrg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ijrg_ c.2.1.0 (G:) automated matches {Bacillus anthracis [TaxId: 261594]}
vtmpaqhqnkqpgieslmnplpqfedpnykgseklkgknvlitggdsgigravsiafake
ganiaiayldeegdanetkqyvekegvkcvllpgdlsdeqhckdivqetvrqlgslnilv
nnvaqqypqqgleyitaeqlektfrinifsyfhvtkaalshlkqgdviintasivayegn
etlidysatkgaivaftrslsqslvqkgirvngvapgpiwtplipssfdekkvsqfgsnv
pmqrpgqpyelapayvylassdssyvtgqmihvnggvivng
Timeline for d3ijrg_: