Lineage for d3idsa2 (3ids A:165-333)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203128Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2203219Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species)
  7. 2203423Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries)
  8. 2203424Domain d3idsa2: 3ids A:165-333 [211591]
    Other proteins in same PDB: d3idsa1, d3idsb1, d3idsc1, d3idsd1
    automated match to d1k3ta2
    complexed with acm, gol, nad

Details for d3idsa2

PDB Entry: 3ids (more details), 1.8 Å

PDB Description: Structure of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi in complex with the irreversible iodoacetamide inhibitor
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d3idsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3idsa2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

SCOPe Domain Coordinates for d3idsa2:

Click to download the PDB-style file with coordinates for d3idsa2.
(The format of our PDB-style files is described here.)

Timeline for d3idsa2: