| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
| Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species) |
| Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries) |
| Domain d3idsa2: 3ids A:165-333 [211591] Other proteins in same PDB: d3idsa1, d3idsb1, d3idsc1, d3idsd1 automated match to d1k3ta2 complexed with acm, gol, nad |
PDB Entry: 3ids (more details), 1.8 Å
SCOPe Domain Sequences for d3idsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3idsa2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy
Timeline for d3idsa2: