Lineage for d3ibea3 (3ibe A:525-725)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1500710Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 1500711Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 1500712Species Human (Homo sapiens) [TaxId:9606] [48402] (57 PDB entries)
  8. 1500744Domain d3ibea3: 3ibe A:525-725 [211567]
    Other proteins in same PDB: d3ibea1, d3ibea2, d3ibea4
    automated match to d1e8ya1
    complexed with l64, so4

Details for d3ibea3

PDB Entry: 3ibe (more details), 2.8 Å

PDB Description: crystal structure of a pyrazolopyrimidine inhibitor bound to pi3 kinase gamma
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3ibea3:

Sequence, based on SEQRES records: (download)

>d3ibea3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d3ibea3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkay
pklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqkle
sledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhy
qqrfavileaylrgcg

SCOPe Domain Coordinates for d3ibea3:

Click to download the PDB-style file with coordinates for d3ibea3.
(The format of our PDB-style files is described here.)

Timeline for d3ibea3: