SCOP 1.71: Domain d1ad0a2: 1ad0 A:108-213

Lineage for d1ad0a2 (1ad0 A:108-213)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1ad0a2: 1ad0 A:108-213 [21154]
Other proteins in same PDB: d1ad0a1, d1ad0b1, d1ad0b2, d1ad0c1, d1ad0d1, d1ad0d2

Details for d1ad0a2

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7

SCOP Domain Sequences for d1ad0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0a2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1ad0a2:

Click to download the PDB-style file with coordinates for d1ad0a2.
(The format of our PDB-style files is described here.)

Timeline for d1ad0a2: