![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
![]() | Domain d1ad0a2: 1ad0 A:108-213 [21154] Other proteins in same PDB: d1ad0a1, d1ad0b1, d1ad0b2, d1ad0c1, d1ad0d1, d1ad0d2 |
PDB Entry: 1ad0 (more details), 2.5 Å
SCOP Domain Sequences for d1ad0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad0a2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1ad0a2: