Lineage for d1ad0a2 (1ad0 A:108-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 656018Domain d1ad0a2: 1ad0 A:108-213 [21154]
    Other proteins in same PDB: d1ad0a1, d1ad0b1, d1ad0b2, d1ad0c1, d1ad0d1, d1ad0d2

Details for d1ad0a2

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7
PDB Compounds: (A:) antibody a5b7 (light chain)

SCOP Domain Sequences for d1ad0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0a2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1ad0a2:

Click to download the PDB-style file with coordinates for d1ad0a2.
(The format of our PDB-style files is described here.)

Timeline for d1ad0a2: