SCOPe 2.04: Domain d3hvqb_: 3hvq B:

Lineage for d3hvqb_ (3hvq B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein automated matches [190344] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187171] (6 PDB entries)

8. Domain d3hvqb_: 3hvq B: [211308]
   automated match to d1s70a_
   complexed with gol, mn, po4

Details for d3hvqb_

PDB Entry: 3hvq, 2.2 Å

PDB Description: Crystal structure of a complex between Protein Phosphatase 1 alpha (PP1) and the PP1 binding and PDZ domains of Neurabin

PDB Compounds: (B:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3hvqb_:

Sequence; same for both SEQRES and ATOM records:

>d3hvqb_ d.159.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

Timeline for d3hvqb_:

• d3hvqb_ first appeared in SCOPe 2.03
  
• d3hvqb_ appears in SCOPe 2.05
  
• d3hvqb_ appears in the current release, SCOPe 2.08