Lineage for d3hvqb_ (3hvq B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440476Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1440477Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1440548Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1440639Protein automated matches [190344] (1 species)
    not a true protein
  7. 1440640Species Human (Homo sapiens) [TaxId:9606] [187171] (5 PDB entries)
  8. 1440648Domain d3hvqb_: 3hvq B: [211308]
    automated match to d1s70a_
    complexed with gol, mn, po4

Details for d3hvqb_

PDB Entry: 3hvq (more details), 2.2 Å

PDB Description: Crystal structure of a complex between Protein Phosphatase 1 alpha (PP1) and the PP1 binding and PDZ domains of Neurabin
PDB Compounds: (B:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3hvqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hvqb_ d.159.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

SCOPe Domain Coordinates for d3hvqb_:

Click to download the PDB-style file with coordinates for d3hvqb_.
(The format of our PDB-style files is described here.)

Timeline for d3hvqb_: