Lineage for d1vgeh2 (1vge H:123-225)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933318Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 933326Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 933359Domain d1vgeh2: 1vge H:123-225 [21127]
    Other proteins in same PDB: d1vgeh1, d1vgel1, d1vgel2
    part of humanized Fab TR1.9

Details for d1vgeh2

PDB Entry: 1vge (more details), 2 Å

PDB Description: tr1.9 fab fragment of a human igg1 kappa autoantibody
PDB Compounds: (H:) tr1.9 fab

SCOPe Domain Sequences for d1vgeh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgeh2 b.1.1.2 (H:123-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d1vgeh2:

Click to download the PDB-style file with coordinates for d1vgeh2.
(The format of our PDB-style files is described here.)

Timeline for d1vgeh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vgeh1