SCOPe 2.08: Domain d3hq6a2: 3hq6 A:189-345

Lineage for d3hq6a2 (3hq6 A:189-345)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (26 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)

8. Domain d3hq6a2: 3hq6 A:189-345 [211211]
   automated match to d1nmla2
   complexed with ca, hem

Details for d3hq6a2

PDB Entry: 3hq6, 2 Å

PDB Description: Cytochrome c peroxidase from G. sulfurreducens, wild type

PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d3hq6a2:

Sequence; same for both SEQRES and ATOM records:

>d3hq6a2 a.3.1.0 (A:189-345) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
dspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvvekpaenilp
lgdkgrfavtntakdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsaqfgiklsd
deseaiaaflgsltgkqpkvvypimpastdatprprl

Timeline for d3hq6a2:

• d3hq6a2 first appeared in SCOPe 2.03
  
• d3hq6a2 appears in SCOPe 2.07