| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (26 species) not a true protein |
| Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries) |
| Domain d3hq6a1: 3hq6 A:22-188 [211210] automated match to d1nmla1 complexed with ca, hem |
PDB Entry: 3hq6 (more details), 2 Å
SCOPe Domain Sequences for d3hq6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hq6a1 a.3.1.0 (A:22-188) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
adelqqraqglfkpvpakaptlkgnpaspvkvelgkmlyfdprlsashliscntchnvgl
gggdlqatstghgwqkgprnaptvlnsvfntaqfwdgrakdlaeqakgpvqasvemnntp
dqvvktlnsipdyvalfkkafpgekdpvtfdnmakaievfeatlitp
Timeline for d3hq6a1: