SCOPe 2.08: Domain d3hq0b1: 3hq0 B:2-146

Lineage for d3hq0b1 (3hq0 B:2-146)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:237609] [225772] (3 PDB entries)

8. Domain d3hq0b1: 3hq0 B:2-146 [211204]
   automated match to d1mpya1
   complexed with fe, m3p

Details for d3hq0b1

PDB Entry: 3hq0, 2 Å

PDB Description: crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in complex with a product

PDB Compounds: (B:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d3hq0b1:

Sequence; same for both SEQRES and ATOM records:

>d3hq0b1 d.32.1.0 (B:2-146) automated matches {Pseudomonas sp. [TaxId: 237609]}
amtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiirea
dtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliely
aektcvgngisevnpapwnaqrehg

Timeline for d3hq0b1:

• d3hq0b1 first appeared in SCOPe 2.03
  
• d3hq0b1 appears in SCOPe 2.07