PDB entry 3hq0

View 3hq0 on RCSB PDB site
Description: Crystal Structure Analysis of the 2,3-dioxygenase LapB from Pseudomonas in complex with a product
Class: oxidoreductase
Keywords: repeated motifs, Aromatic hydrocarbons catabolism, Dioxygenase, Iron, Oxidoreductase
Deposited on 2009-06-05, released 2009-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catechol 2,3-dioxygenase
    Species: Pseudomonas sp. KL28 [TaxId:237609]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hq0a1, d3hq0a2
  • Chain 'B':
    Compound: catechol 2,3-dioxygenase
    Species: Pseudomonas sp. KL28 [TaxId:237609]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hq0b1, d3hq0b2
  • Chain 'C':
    Compound: catechol 2,3-dioxygenase
    Species: Pseudomonas sp. KL28 [TaxId:237609]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hq0c1, d3hq0c2
  • Chain 'D':
    Compound: catechol 2,3-dioxygenase
    Species: Pseudomonas sp. KL28 [TaxId:237609]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hq0d1, d3hq0d2
  • Heterogens: FE, M3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hq0A (A:)
    mamtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiire
    adtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliel
    yaektcvgngisevnpapwnaqrehgiapiqldhcllygpniaevqkiftevlgfylver
    vlspdgdsdmgiwlscshkvhdiafveypekgklhhcsfllesweqvlragdimsmnevn
    vdigptrhgvtrgctiyawdpsgnrfetfmggyhpypdyeplswtydnfaqgldypqrkl
    hetfmtvvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hq0A (A:)
    amtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiirea
    dtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliely
    aektcvgngisevnpapwnaqrehgiapiqldhcllygpniaevqkiftevlgfylverv
    lspdgdsdmgiwlscshkvhdiafveypekgklhhcsfllesweqvlragdimsmnevnv
    digptrhgvtrgctiyawdpsgnrfetfmggyhpypdyeplswtydnfaqgldypqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hq0B (B:)
    mamtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiire
    adtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliel
    yaektcvgngisevnpapwnaqrehgiapiqldhcllygpniaevqkiftevlgfylver
    vlspdgdsdmgiwlscshkvhdiafveypekgklhhcsfllesweqvlragdimsmnevn
    vdigptrhgvtrgctiyawdpsgnrfetfmggyhpypdyeplswtydnfaqgldypqrkl
    hetfmtvvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hq0B (B:)
    amtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiirea
    dtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliely
    aektcvgngisevnpapwnaqrehgiapiqldhcllygpniaevqkiftevlgfylverv
    lspdgdsdmgiwlscshkvhdiafveypekgklhhcsfllesweqvlragdimsmnevnv
    digptrhgvtrgctiyawdpsgnrfetfmggyhpypdyeplswtydnf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hq0C (C:)
    mamtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiire
    adtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliel
    yaektcvgngisevnpapwnaqrehgiapiqldhcllygpniaevqkiftevlgfylver
    vlspdgdsdmgiwlscshkvhdiafveypekgklhhcsfllesweqvlragdimsmnevn
    vdigptrhgvtrgctiyawdpsgnrfetfmggyhpypdyeplswtydnfaqgldypqrkl
    hetfmtvvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hq0C (C:)
    amtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiirea
    dtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliely
    aektcvgngisevnpapwnaqrehgiapiqldhcllygpniaevqkiftevlgfylverv
    lspdgdsdmgiwlscshkvhdiafveypekgklhhcsfllesweqvlragdimsmnevnv
    digptrhgvtrgctiyawdpsgnrfetfmggyhpypdyeplswtydnfaqgldypq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hq0D (D:)
    mamtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiire
    adtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliel
    yaektcvgngisevnpapwnaqrehgiapiqldhcllygpniaevqkiftevlgfylver
    vlspdgdsdmgiwlscshkvhdiafveypekgklhhcsfllesweqvlragdimsmnevn
    vdigptrhgvtrgctiyawdpsgnrfetfmggyhpypdyeplswtydnfaqgldypqrkl
    hetfmtvvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hq0D (D:)
    amtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiirea
    dtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliely
    aektcvgngisevnpapwnaqrehgiapiqldhcllygpniaevqkiftevlgfylverv
    lspdgdsdmgiwlscshkvhdiafveypekgklhhcsfllesweqvlragdimsmnevnv
    digptrhgvtrgctiyawdpsgnrfetfmggyhpypdyeplswtydnf