Lineage for d3hpyc1 (3hpy C:2-146)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645158Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1645159Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1645582Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 1645583Protein automated matches [190239] (16 species)
    not a true protein
  7. 1645637Species Pseudomonas sp. [TaxId:237609] [225772] (3 PDB entries)
  8. 1645650Domain d3hpyc1: 3hpy C:2-146 [211198]
    automated match to d1mpya1
    complexed with fe, mct

Details for d3hpyc1

PDB Entry: 3hpy (more details), 1.94 Å

PDB Description: crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in the complex with 4-methylcatechol
PDB Compounds: (C:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d3hpyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hpyc1 d.32.1.0 (C:2-146) automated matches {Pseudomonas sp. [TaxId: 237609]}
amtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiirea
dtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliely
aektcvgngisevnpapwnaqrehg

SCOPe Domain Coordinates for d3hpyc1:

Click to download the PDB-style file with coordinates for d3hpyc1.
(The format of our PDB-style files is described here.)

Timeline for d3hpyc1: