Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (16 species) not a true protein |
Species Pseudomonas sp. [TaxId:237609] [225772] (3 PDB entries) |
Domain d3hpya2: 3hpy A:147-289 [211195] automated match to d1mpya2 complexed with fe, mct |
PDB Entry: 3hpy (more details), 1.94 Å
SCOPe Domain Sequences for d3hpya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hpya2 d.32.1.0 (A:147-289) automated matches {Pseudomonas sp. [TaxId: 237609]} iapiqldhcllygpniaevqkiftevlgfylvervlspdgdsdmgiwlscshkvhdiafv eypekgklhhcsfllesweqvlragdimsmnevnvdigptrhgvtrgctiyawdpsgnrf etfmggyhpypdyeplswtydnf
Timeline for d3hpya2: