SCOPe 2.04: Domain d3hm8a2: 3hm8 A:677-919

Lineage for d3hm8a2 (3hm8 A:677-919)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (40 PDB entries)

8. Domain d3hm8a2: 3hm8 A:677-919 [211122]
   automated match to d1bdga2
   complexed with bg6, glc

Details for d3hm8a2

PDB Entry: 3hm8, 2.8 Å

PDB Description: crystal structure of the c-terminal hexokinase domain of human hk3

PDB Compounds: (A:) Hexokinase-3

SCOPe Domain Sequences for d3hm8a2:

Sequence; same for both SEQRES and ATOM records:

>d3hm8a2 c.55.1.0 (A:677-919) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rceiglivgtgtnacymeelrnvagvpgdsgrmcinmewgafgddgslamlstrfdasvd
qasinpgkqrfekmisgmylgeivrhillhltslgvlfrgqqiqrlqtrdifktkflsei
esdslalrqvrailedlglpltsddalmvlevcqavsqraaqlcgagvaavvekirenrg
leelavsvgvdgtlyklhprfsslvaatvrelaprcvvtflqsedgsgkgaalvtavacr
laq

Timeline for d3hm8a2:

• d3hm8a2 first appeared in SCOPe 2.03
  
• d3hm8a2 appears in SCOPe 2.05
  
• d3hm8a2 appears in the current release, SCOPe 2.08