Lineage for d3hm8a2 (3hm8 A:677-919)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373429Species Human (Homo sapiens) [TaxId:9606] [224896] (31 PDB entries)
  8. 1373502Domain d3hm8a2: 3hm8 A:677-919 [211122]
    automated match to d1bdga2
    complexed with bg6, glc

Details for d3hm8a2

PDB Entry: 3hm8 (more details), 2.8 Å

PDB Description: crystal structure of the c-terminal hexokinase domain of human hk3
PDB Compounds: (A:) Hexokinase-3

SCOPe Domain Sequences for d3hm8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hm8a2 c.55.1.0 (A:677-919) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rceiglivgtgtnacymeelrnvagvpgdsgrmcinmewgafgddgslamlstrfdasvd
qasinpgkqrfekmisgmylgeivrhillhltslgvlfrgqqiqrlqtrdifktkflsei
esdslalrqvrailedlglpltsddalmvlevcqavsqraaqlcgagvaavvekirenrg
leelavsvgvdgtlyklhprfsslvaatvrelaprcvvtflqsedgsgkgaalvtavacr
laq

SCOPe Domain Coordinates for d3hm8a2:

Click to download the PDB-style file with coordinates for d3hm8a2.
(The format of our PDB-style files is described here.)

Timeline for d3hm8a2: