Lineage for d3hhqd_ (3hhq D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332308Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1332444Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1332637Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 1332638Protein automated matches [191182] (7 species)
    not a true protein
  7. 1332722Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189530] (3 PDB entries)
  8. 1332732Domain d3hhqd_: 3hhq D: [211043]
    automated match to d1sixa_
    complexed with cl, edo, gol, na, peg, so4

Details for d3hhqd_

PDB Entry: 3hhq (more details), 2 Å

PDB Description: Crystal structure of apo dUT1p from Saccharomyces cerevisiae
PDB Compounds: (D:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3hhqd_:

Sequence, based on SEQRES records: (download)

>d3hhqd_ b.85.4.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
vvvdsl

Sequence, based on observed residues (ATOM records): (download)

>d3hhqd_ b.85.4.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvlkiqlrsasatvptksataagydiyasqditipamgqgmvstdisftvpvgtygriap
rsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqiv
vvdsl

SCOPe Domain Coordinates for d3hhqd_:

Click to download the PDB-style file with coordinates for d3hhqd_.
(The format of our PDB-style files is described here.)

Timeline for d3hhqd_: