Lineage for d3hhqk_ (3hhq K:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332308Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1332444Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1332637Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 1332638Protein automated matches [191182] (7 species)
    not a true protein
  7. 1332722Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189530] (3 PDB entries)
  8. 1332739Domain d3hhqk_: 3hhq K: [211050]
    automated match to d1sixa_
    complexed with cl, edo, gol, na, peg, so4

Details for d3hhqk_

PDB Entry: 3hhq (more details), 2 Å

PDB Description: Crystal structure of apo dUT1p from Saccharomyces cerevisiae
PDB Compounds: (K:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3hhqk_:

Sequence, based on SEQRES records: (download)

>d3hhqk_ b.85.4.0 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria
prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi
vvvdslee

Sequence, based on observed residues (ATOM records): (download)

>d3hhqk_ b.85.4.0 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvlkiqlrsasatvptksataagydiyasqditipamgqgmvstdisftvpvgtygriap
rsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqiv
vvdslee

SCOPe Domain Coordinates for d3hhqk_:

Click to download the PDB-style file with coordinates for d3hhqk_.
(The format of our PDB-style files is described here.)

Timeline for d3hhqk_: