SCOPe 2.07: Domain d1fbil2: 1fbi L:108-214

Lineage for d1fbil2 (1fbi L:108-214)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Mouse (Mus musculus) [TaxId:10090] [88567] (368 PDB entries)
Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

Domain d1fbil2: 1fbi L:108-214 [21078]
Other proteins in same PDB: d1fbih1, d1fbih2, d1fbih3, d1fbil1, d1fbip1, d1fbiq1, d1fbiq2, d1fbiq3, d1fbix_, d1fbiy_
part of Fab F9.13.7

Details for d1fbil2

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

PDB Compounds: (L:) igg1 f9.13.7 fab (light chain)

SCOPe Domain Sequences for d1fbil2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbil2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1fbil2:

Click to download the PDB-style file with coordinates for d1fbil2.
(The format of our PDB-style files is described here.)

Timeline for d1fbil2: