Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab 17E8 (mouse), kappa L chain [49013] (1 PDB entry) |
Domain d1eapb2: 1eap B:125-221 [21069] Other proteins in same PDB: d1eapa1, d1eapb1 complexed with hep |
PDB Entry: 1eap (more details), 2.5 Å
SCOP Domain Sequences for d1eapb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eapb2 b.1.1.2 (B:125-221) Immunoglobulin (constant domains of L and H chains) {Fab 17E8 (mouse), kappa L chain} akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgglsssvhtfpallqsg lytmsssvtvpgggwpsatvtcsvahpassttvdkkl
Timeline for d1eapb2: