Lineage for d3gvie2 (3gvi E:145-320)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680841Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1680842Protein automated matches [226850] (24 species)
    not a true protein
  7. 1680877Species Brucella melitensis [TaxId:359391] [225649] (2 PDB entries)
  8. 1680882Domain d3gvie2: 3gvi E:145-320 [210684]
    Other proteins in same PDB: d3gvia1, d3gvib1, d3gvic1, d3gvid1, d3gvie1, d3gvif1
    automated match to d1guza2
    complexed with adp

Details for d3gvie2

PDB Entry: 3gvi (more details), 2.25 Å

PDB Description: Crystal structure of Lactate/malate dehydrogenase from Brucella melitensis in complex with ADP
PDB Compounds: (E:) malate dehydrogenase

SCOPe Domain Sequences for d3gvie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvie2 d.162.1.0 (E:145-320) automated matches {Brucella melitensis [TaxId: 359391]}
agvldsarfryflseefnvsvedvtvfvlgghgdsmvplarystvagiplpdlvkmgwts
qdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesylkdkkrvlpvaaqlsgqy
gvkdmyvgvptvigangveriieidldkdekaqfdksvasvaglceacigiapslk

SCOPe Domain Coordinates for d3gvie2:

Click to download the PDB-style file with coordinates for d3gvie2.
(The format of our PDB-style files is described here.)

Timeline for d3gvie2: