| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
| Protein automated matches [226850] (24 species) not a true protein |
| Species Brucella melitensis [TaxId:359391] [225649] (2 PDB entries) |
| Domain d3gvia2: 3gvi A:145-320 [210676] Other proteins in same PDB: d3gvia1, d3gvib1, d3gvic1, d3gvid1, d3gvie1, d3gvif1 automated match to d1guza2 complexed with adp |
PDB Entry: 3gvi (more details), 2.25 Å
SCOPe Domain Sequences for d3gvia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gvia2 d.162.1.0 (A:145-320) automated matches {Brucella melitensis [TaxId: 359391]}
agvldsarfryflseefnvsvedvtvfvlgghgdsmvplarystvagiplpdlvkmgwts
qdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesylkdkkrvlpvaaqlsgqy
gvkdmyvgvptvigangveriieidldkdekaqfdksvasvaglceacigiapslk
Timeline for d3gvia2: