Lineage for d3gvhd2 (3gvh D:145-319)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680841Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1680842Protein automated matches [226850] (24 species)
    not a true protein
  7. 1680877Species Brucella melitensis [TaxId:359391] [225649] (2 PDB entries)
  8. 1680887Domain d3gvhd2: 3gvh D:145-319 [210674]
    Other proteins in same PDB: d3gvha1, d3gvhb1, d3gvhc1, d3gvhd1
    automated match to d1guza2
    complexed with nad

Details for d3gvhd2

PDB Entry: 3gvh (more details), 2.3 Å

PDB Description: Crystal structure of Lactate/malate dehydrogenase from Brucella melitensis
PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d3gvhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvhd2 d.162.1.0 (D:145-319) automated matches {Brucella melitensis [TaxId: 359391]}
agvldsarfryflseefnvsvedvtvfvlgghgdsmvplarystvagiplpdlvkmgwts
qdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesylkdkkrvlpvaaqlsgqy
gvkdmyvgvptvigangveriieidldkdekaqfdksvasvaglceacigiapsl

SCOPe Domain Coordinates for d3gvhd2:

Click to download the PDB-style file with coordinates for d3gvhd2.
(The format of our PDB-style files is described here.)

Timeline for d3gvhd2: