SCOPe 2.05: Domain d3gvhd2: 3gvh D:145-319

Lineage for d3gvhd2 (3gvh D:145-319)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (26 species)
   not a true protein

7. Species Brucella melitensis [TaxId:359391] [225649] (2 PDB entries)

8. Domain d3gvhd2: 3gvh D:145-319 [210674]
   Other proteins in same PDB: d3gvha1, d3gvhb1, d3gvhc1, d3gvhd1
   automated match to d1guza2
   complexed with nad

Details for d3gvhd2

PDB Entry: 3gvh, 2.3 Å

PDB Description: Crystal structure of Lactate/malate dehydrogenase from Brucella melitensis

PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d3gvhd2:

Sequence; same for both SEQRES and ATOM records:

>d3gvhd2 d.162.1.0 (D:145-319) automated matches {Brucella melitensis [TaxId: 359391]}
agvldsarfryflseefnvsvedvtvfvlgghgdsmvplarystvagiplpdlvkmgwts
qdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesylkdkkrvlpvaaqlsgqy
gvkdmyvgvptvigangveriieidldkdekaqfdksvasvaglceacigiapsl

Timeline for d3gvhd2:

• d3gvhd2 first appeared in SCOPe 2.03
  
• d3gvhd2 appears in SCOPe 2.04
  
• d3gvhd2 appears in SCOPe 2.06
  
• d3gvhd2 appears in the current release, SCOPe 2.08