Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (17 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries) |
Domain d3gncb1: 3gnc B:4-242 [210611] Other proteins in same PDB: d3gnca2, d3gncb2, d3gncc2, d3gncd2 automated match to d1siqa2 complexed with epe, qqq, so4 |
PDB Entry: 3gnc (more details), 2.15 Å
SCOPe Domain Sequences for d3gncb1:
Sequence, based on SEQRES records: (download)
>d3gncb1 e.6.1.0 (B:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]} atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg
>d3gncb1 e.6.1.0 (B:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]} atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky lpklatgewigcfgltepmvtrarkvpggyslsgskmwitnspiadvfvvwakldedeir gfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg
Timeline for d3gncb1: