| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
| Protein automated matches [226935] (18 species) not a true protein |
| Species Burkholderia pseudomallei [TaxId:320372] [225463] (6 PDB entries) |
| Domain d3gncd2: 3gnc D:243-393 [210616] Other proteins in same PDB: d3gnca1, d3gncb1, d3gncc1, d3gncd1 automated match to d1siqa1 complexed with epe, qqq, so4 |
PDB Entry: 3gnc (more details), 2.15 Å
SCOPe Domain Sequences for d3gncd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gncd2 a.29.3.0 (D:243-393) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvar
hlvnlevvntyegthdihalilgraqtgiqa
Timeline for d3gncd2: