SCOPe 2.07: Domain d3gmjd_: 3gmj D:

Lineage for d3gmjd_ (3gmj D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.0: automated matches [191616] (1 protein)
   not a true family

6. Protein automated matches [191125] (8 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225792] (1 PDB entry)

8. Domain d3gmjd_: 3gmj D: [210598]
   automated match to d1mr1b_

Details for d3gmjd_

PDB Entry: 3gmj, 2.8 Å

PDB Description: Crystal structure of MAD MH2 domain

PDB Compounds: (D:) Protein mothers against dpp

SCOPe Domain Sequences for d3gmjd_:

Sequence; same for both SEQRES and ATOM records:

>d3gmjd_ b.26.1.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
epafwasiayyelncrvgevfhcnnnsvivdgftnpsnnsdrcclgqlsnvnrnstient
rrhigkgvhlyyvtgevyaeclsdsaifvqsrncnyqhgfhpstvckippgcslkifnnq
efaqllsqsvnngfeavyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqw
ldkvltqmgsphnaissvs

Timeline for d3gmjd_:

• d3gmjd_ first appeared in SCOPe 2.03
  
• d3gmjd_ appears in SCOPe 2.06
  
• d3gmjd_ appears in the current release, SCOPe 2.08