Lineage for d3gmjd_ (3gmj D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778206Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2778207Protein automated matches [191125] (8 species)
    not a true protein
  7. 2778220Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225792] (1 PDB entry)
  8. 2778224Domain d3gmjd_: 3gmj D: [210598]
    automated match to d1mr1b_

Details for d3gmjd_

PDB Entry: 3gmj (more details), 2.8 Å

PDB Description: Crystal structure of MAD MH2 domain
PDB Compounds: (D:) Protein mothers against dpp

SCOPe Domain Sequences for d3gmjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gmjd_ b.26.1.0 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
epafwasiayyelncrvgevfhcnnnsvivdgftnpsnnsdrcclgqlsnvnrnstient
rrhigkgvhlyyvtgevyaeclsdsaifvqsrncnyqhgfhpstvckippgcslkifnnq
efaqllsqsvnngfeavyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqw
ldkvltqmgsphnaissvs

SCOPe Domain Coordinates for d3gmjd_:

Click to download the PDB-style file with coordinates for d3gmjd_.
(The format of our PDB-style files is described here.)

Timeline for d3gmjd_: