Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries) |
Domain d2gfbk2: 2gfb K:109-214 [21056] Other proteins in same PDB: d2gfba1, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbp1, d2gfbp2 |
PDB Entry: 2gfb (more details), 3 Å
SCOP Domain Sequences for d2gfbk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbk2 b.1.1.2 (K:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} ggaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d2gfbk2:
View in 3D Domains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp1, d2gfbp2 |