SCOP 1.67: Domain d2gfbg1: 2gfb G:1-108

Lineage for d2gfbg1 (2gfb G:1-108)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d2gfbg1: 2gfb G:1-108 [19998]
   Other proteins in same PDB: d2gfba2, d2gfbb1, d2gfbb2, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo2, d2gfbp1, d2gfbp2

Details for d2gfbg1

PDB Entry: 2gfb, 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfbg1:

Sequence; same for both SEQRES and ATOM records:

>d2gfbg1 b.1.1.1 (G:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilr

Timeline for d2gfbg1:

• d2gfbg1 first appeared (with stable ids) in SCOP 1.55
  
• d2gfbg1 appears in SCOP 1.65
  
• d2gfbg1 appears in SCOP 1.69
  
• d2gfbg1 appears in the current release, SCOPe 2.08