Lineage for d2gfbk1 (2gfb K:1-108)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363836Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)
  8. 364037Domain d2gfbk1: 2gfb K:1-108 [20002]
    Other proteins in same PDB: d2gfba2, d2gfbb1, d2gfbb2, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo2, d2gfbp1, d2gfbp2

Details for d2gfbk1

PDB Entry: 2gfb (more details), 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfbk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfbk1 b.1.1.1 (K:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilr

SCOP Domain Coordinates for d2gfbk1:

Click to download the PDB-style file with coordinates for d2gfbk1.
(The format of our PDB-style files is described here.)

Timeline for d2gfbk1: