Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins) automatically mapped to Pfam PF00644 |
Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [103339] (8 PDB entries) Uniprot P09874 661-1010 |
Domain d3gjwa2: 3gjw A:136-350 [210551] Other proteins in same PDB: d3gjwa1 automated match to d1gs0a2 protein/DNA complex; complexed with gjw |
PDB Entry: 3gjw (more details), 2.3 Å
SCOPe Domain Sequences for d3gjwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gjwa2 d.166.1.2 (A:136-350) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d3gjwa2: