Lineage for d3gjwa2 (3gjw A:136-350)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441943Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1441944Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1442144Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 1442145Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 1442154Species Human (Homo sapiens) [TaxId:9606] [103339] (9 PDB entries)
    Uniprot P09874 661-1010
  8. 1442155Domain d3gjwa2: 3gjw A:136-350 [210551]
    Other proteins in same PDB: d3gjwa1
    automated match to d1gs0a2
    protein/DNA complex; complexed with gjw

Details for d3gjwa2

PDB Entry: 3gjw (more details), 2.3 Å

PDB Description: parp complexed with a968427
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d3gjwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gjwa2 d.166.1.2 (A:136-350) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d3gjwa2:

Click to download the PDB-style file with coordinates for d3gjwa2.
(The format of our PDB-style files is described here.)

Timeline for d3gjwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gjwa1