SCOPe 2.03: Domain d3gbda2: 3gbd A:494-573

Lineage for d3gbda2 (3gbd A:494-573)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (18 species)
   not a true protein

7. Species Protaminobacter rubrum [TaxId:126825] [225681] (2 PDB entries)

8. Domain d3gbda2: 3gbd A:494-573 [210476]
   Other proteins in same PDB: d3gbda1
   automated match to d1m53a1
   complexed with edo, flc

Details for d3gbda2

PDB Entry: 3gbd, 1.95 Å

PDB Description: Crystal structure of the isomaltulose synthase SmuA from Protaminobacter rubrum

PDB Compounds: (A:) Sucrose isomerase SmuA from Protaminobacter rubrum

SCOPe Domain Sequences for d3gbda2:

Sequence; same for both SEQRES and ATOM records:

>d3gbda2 b.71.1.0 (A:494-573) automated matches {Protaminobacter rubrum [TaxId: 126825]}
gtytdldpandsvyaytrslgaekylvvvnfkeqmmryklpdnlsiekviidsnsknvvk
kndsllelkpwqsgvyklnq

Timeline for d3gbda2:

• d3gbda2 is new in SCOPe 2.03-stable
  
• d3gbda2 appears in SCOPe 2.04
  
• d3gbda2 appears in the current release, SCOPe 2.08