PDB entry 3gbd

View 3gbd on RCSB PDB site
Description: Crystal structure of the isomaltulose synthase SmuA from Protaminobacter rubrum
Class: isomerase
Keywords: sucrose isomerase, glycoside hydrolase, Protaminobacter rubrum
Deposited on 2009-02-19, released 2009-05-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose isomerase SmuA from Protaminobacter rubrum
    Species: Protaminobacter rubrum [TaxId:126825]
    Gene: smuA
    Database cross-references and differences (RAF-indexed):
    • PDB 3GBD (0-557)
    Domains in SCOPe 2.03: d3gbda1, d3gbda2
  • Heterogens: EDO, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gbdA (A:)
    tipkwwkeavfyqvyprsfkdtngdgigdingiiekldylkalgidaiwinphydspntd
    ngydirdyrkimkeygtmedfdrlisemkkrnmrlmidvvinhtsdqnewfvksksskdn
    pyrgyyfwkdakegqapnnypsffggsawqkdektnqyylhyfakqqpdlnwdnpkvrqd
    lyamlrfwldkgvsglrfdtvatyskipdfpnltqqqlknfaaeytkgpnihryvnemnk
    evlshydiatageifgvpldqsikffdrrrdelniaftfdlirldrdsdqrwrrkdwkls
    qfrqiidnvdrtageygwnaffldnhdnpravshfgddrpqwrepsakalatltltqrat
    pfiyqgselgmtnypfkaidefddievkgfwhdyvetgkvkadeflqnvrltsrdnsrtp
    fqwdgsknagftsgkpwfkvnpnyqeinavsqvtqpdsvfnyyrqlikirhdipaltygt
    ytdldpandsvyaytrslgaekylvvvnfkeqmmryklpdnlsiekviidsnsknvvkkn
    dsllelkpwqsgvyklnq