Lineage for d3g25c1 (3g25 C:1-252)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858951Species Staphylococcus aureus [TaxId:93062] [225611] (2 PDB entries)
  8. 1858956Domain d3g25c1: 3g25 C:1-252 [210318]
    automated match to d1glfo1
    complexed with gol, na, po4

Details for d3g25c1

PDB Entry: 3g25 (more details), 1.9 Å

PDB Description: 1.9 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with glycerol.
PDB Compounds: (C:) glycerol kinase

SCOPe Domain Sequences for d3g25c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g25c1 c.55.1.0 (C:1-252) automated matches {Staphylococcus aureus [TaxId: 93062]}
mekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvlavmt
evinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqqgye
qtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaahit
dysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevpiag
vagdqqaalfgq

SCOPe Domain Coordinates for d3g25c1:

Click to download the PDB-style file with coordinates for d3g25c1.
(The format of our PDB-style files is described here.)

Timeline for d3g25c1: