| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93062] [225611] (2 PDB entries) |
| Domain d3g25c1: 3g25 C:1-252 [210318] Other proteins in same PDB: d3g25a3, d3g25b3, d3g25d3 automated match to d1glfo1 complexed with gol, na, po4 |
PDB Entry: 3g25 (more details), 1.9 Å
SCOPe Domain Sequences for d3g25c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g25c1 c.55.1.0 (C:1-252) automated matches {Staphylococcus aureus [TaxId: 93062]}
mekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvlavmt
evinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqqgye
qtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaahit
dysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevpiag
vagdqqaalfgq
Timeline for d3g25c1: