SCOPe 2.05: Domain d3g25b1: 3g25 B:0-252

Lineage for d3g25b1 (3g25 B:0-252)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225611] (2 PDB entries)

8. Domain d3g25b1: 3g25 B:0-252 [210316]
   automated match to d1glfo1
   complexed with gol, na, po4

Details for d3g25b1

PDB Entry: 3g25, 1.9 Å

PDB Description: 1.9 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with glycerol.

PDB Compounds: (B:) glycerol kinase

SCOPe Domain Sequences for d3g25b1:

Sequence; same for both SEQRES and ATOM records:

>d3g25b1 c.55.1.0 (B:0-252) automated matches {Staphylococcus aureus [TaxId: 93062]}
amekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvlavm
tevinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqqgy
eqtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaahi
tdysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevpia
gvagdqqaalfgq

Timeline for d3g25b1:

• d3g25b1 first appeared in SCOPe 2.03
  
• d3g25b1 appears in SCOPe 2.04
  
• d3g25b1 appears in SCOPe 2.06
  
• d3g25b1 appears in the current release, SCOPe 2.08