SCOPe 2.05: Domain d3g21a_: 3g21 A:

Lineage for d3g21a_ (3g21 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein automated matches [226861] (3 species)
   not a true protein

7. Species Rous sarcoma virus [TaxId:11888] [225677] (7 PDB entries)

8. Domain d3g21a_: 3g21 A: [210313]
   automated match to d1eoqa_
   complexed with no3

Details for d3g21a_

PDB Entry: 3g21, 0.9 Å

PDB Description: Crystal structure of the C-terminal domain of the Rous Sarcoma Virus capsid protein: Low pH

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d3g21a_:

Sequence; same for both SEQRES and ATOM records:

>d3g21a_ a.28.3.1 (A:) automated matches {Rous sarcoma virus [TaxId: 11888]}
agpwadimqgpsesfvdfanrlikavegsdlppsarapviidcfrqksqpdiqqlirtap
stlttpgeiikyvldrq

Timeline for d3g21a_:

• d3g21a_ first appeared in SCOPe 2.03
  
• d3g21a_ appears in SCOPe 2.04
  
• d3g21a_ appears in SCOPe 2.06
  
• d3g21a_ appears in the current release, SCOPe 2.08