| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
| Protein automated matches [226861] (3 species) not a true protein |
| Species Rous sarcoma virus [TaxId:11888] [225677] (7 PDB entries) |
| Domain d3g21a_: 3g21 A: [210313] automated match to d1eoqa_ complexed with no3 |
PDB Entry: 3g21 (more details), 0.9 Å
SCOPe Domain Sequences for d3g21a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g21a_ a.28.3.1 (A:) automated matches {Rous sarcoma virus [TaxId: 11888]}
agpwadimqgpsesfvdfanrlikavegsdlppsarapviidcfrqksqpdiqqlirtap
stlttpgeiikyvldrq
Timeline for d3g21a_: