PDB entry 3g21

View 3g21 on RCSB PDB site
Description: Crystal structure of the C-terminal domain of the Rous Sarcoma Virus capsid protein: Low pH
Class: viral protein
Keywords: alpha-helical bundle, capsid protein, virion, viral protein, retrovirus
Deposited on 2009-01-30, released 2009-06-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 0.9 Å
R-factor: 0.124
AEROSPACI score: 1.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Rous sarcoma virus [TaxId:11888]
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3g21a_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g21A (A:)
    agpwadimqgpsesfvdfanrlikavegsdlppsarapviidcfrqksqpdiqqlirtap
    stlttpgeiikyvldrq