Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
Protein automated matches [226861] (4 species) not a true protein |
Species Rous sarcoma virus [TaxId:11888] [225677] (7 PDB entries) |
Domain d3g1gb_: 3g1g B: [210308] automated match to d1eoqa_ |
PDB Entry: 3g1g (more details), 2.01 Å
SCOPe Domain Sequences for d3g1gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g1gb_ a.28.3.1 (B:) automated matches {Rous sarcoma virus [TaxId: 11888]} gpwadimqgpsesfvdfanrlikavegsdlppsarapviidcfrqksqpdiqqlirtaps tlttpgeiikyvldr
Timeline for d3g1gb_: