Lineage for d3fwnb2 (3fwn B:177-468)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498032Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1498033Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1498233Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1498234Protein automated matches [226851] (26 species)
    not a true protein
  7. 1498255Species Escherichia coli K-12 [TaxId:83333] [225711] (3 PDB entries)
  8. 1498257Domain d3fwnb2: 3fwn B:177-468 [210246]
    Other proteins in same PDB: d3fwna1, d3fwnb1
    automated match to d1pgja1
    complexed with 6pg, atr

Details for d3fwnb2

PDB Entry: 3fwn (more details), 1.5 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d3fwnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fwnb2 a.100.1.0 (B:177-468) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditk
diftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqr
vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygei
akifragciiraqflqkitdayaenpqianlllapyfkqiaddyqqalrdvvayavqigi
pvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtewld

SCOPe Domain Coordinates for d3fwnb2:

Click to download the PDB-style file with coordinates for d3fwnb2.
(The format of our PDB-style files is described here.)

Timeline for d3fwnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fwnb1