Lineage for d3fwnb1 (3fwn B:2-176)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455157Species Escherichia coli K-12 [TaxId:83333] [188668] (7 PDB entries)
  8. 2455167Domain d3fwnb1: 3fwn B:2-176 [210245]
    Other proteins in same PDB: d3fwna2, d3fwnb2
    automated match to d1pgja2
    complexed with 6pg, atr

Details for d3fwnb1

PDB Entry: 3fwn (more details), 1.5 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d3fwnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fwnb1 c.2.1.0 (B:2-176) automated matches {Escherichia coli K-12 [TaxId: 83333]}
skqqigvvgmavmgrnlalniesrgytvsifnrsrekteeviaenpgkklvpyytvkefv
esletprrillmvkagagtdaaidslkpyldkgdiiidggntffqdtirrnrelsaegfn
figtgvsggeegalkgpsimpggqkeayelvapiltkiaavaedgepcvtyigad

SCOPe Domain Coordinates for d3fwnb1:

Click to download the PDB-style file with coordinates for d3fwnb1.
(The format of our PDB-style files is described here.)

Timeline for d3fwnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fwnb2